Placeholder image of a protein
Icon representing a puzzle

2045: Revisiting Puzzle 82: Cytotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 16, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,308
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,887
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,800
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,678
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 8,211
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 0
  1. Avatar for Beany 61. Beany Lv 1 8 pts. 9,154
  2. Avatar for Evica 62. Evica Lv 1 8 pts. 9,151
  3. Avatar for Dr.Sillem 63. Dr.Sillem Lv 1 7 pts. 9,136
  4. Avatar for Merf 64. Merf Lv 1 7 pts. 9,110
  5. Avatar for Alistair69 65. Alistair69 Lv 1 7 pts. 9,086
  6. Avatar for kyoota 66. kyoota Lv 1 6 pts. 9,074
  7. Avatar for pfirth 67. pfirth Lv 1 6 pts. 9,058
  8. Avatar for Flagg65a 68. Flagg65a Lv 1 6 pts. 9,044
  9. Avatar for Deleted player 69. Deleted player 5 pts. 9,030
  10. Avatar for DScott 70. DScott Lv 1 5 pts. 9,012

Comments