Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 8,616
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,320
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 8,027
  4. Avatar for MGC 2020 14. MGC 2020 1 pt. 7,319
  5. Avatar for BT21s 15. BT21s 1 pt. 6,639
  6. Avatar for Window Group 16. Window Group 1 pt. 5,829
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 0
  9. Avatar for Deleted group 19. Deleted group pts. 0

  1. Avatar for Dr.Sillem 91. Dr.Sillem Lv 1 1 pt. 8,157
  2. Avatar for pascal ochem 92. pascal ochem Lv 1 1 pt. 8,072
  3. Avatar for InariInari2020 93. InariInari2020 Lv 1 1 pt. 8,065
  4. Avatar for desuperflo 94. desuperflo Lv 1 1 pt. 8,042
  5. Avatar for FnD Science Team 95. FnD Science Team Lv 1 1 pt. 8,036
  6. Avatar for AlphaFold2 96. AlphaFold2 Lv 1 1 pt. 8,027
  7. Avatar for klonn 97. klonn Lv 1 1 pt. 7,832
  8. Avatar for abiogenesis 98. abiogenesis Lv 1 1 pt. 7,804
  9. Avatar for Mohoernchen 99. Mohoernchen Lv 1 1 pt. 7,768
  10. Avatar for sganesh 100. sganesh Lv 1 1 pt. 7,702

Comments