Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932
  1. Avatar for Dr.Sillem 91. Dr.Sillem Lv 1 1 pt. 8,157
  2. Avatar for pascal ochem 92. pascal ochem Lv 1 1 pt. 8,072
  3. Avatar for InariInari2020 93. InariInari2020 Lv 1 1 pt. 8,065
  4. Avatar for desuperflo 94. desuperflo Lv 1 1 pt. 8,042
  5. Avatar for FnD Science Team 95. FnD Science Team Lv 1 1 pt. 8,036
  6. Avatar for AlphaFold2 96. AlphaFold2 Lv 1 1 pt. 8,027
  7. Avatar for klonn 97. klonn Lv 1 1 pt. 7,832
  8. Avatar for abiogenesis 98. abiogenesis Lv 1 1 pt. 7,804
  9. Avatar for Mohoernchen 99. Mohoernchen Lv 1 1 pt. 7,768
  10. Avatar for sganesh 100. sganesh Lv 1 1 pt. 7,702

Comments