Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 2 pts. 8,616
  2. Avatar for Ogre's lab 12. Ogre's lab 1 pt. 8,320
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 8,027
  4. Avatar for MGC 2020 14. MGC 2020 1 pt. 7,319
  5. Avatar for BT21s 15. BT21s 1 pt. 6,639
  6. Avatar for Window Group 16. Window Group 1 pt. 5,829
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 0
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 0
  9. Avatar for Deleted group 19. Deleted group pts. 0
  1. Avatar for antibioticgel 111. antibioticgel Lv 1 1 pt. 7,202
  2. Avatar for Bufur 112. Bufur Lv 1 1 pt. 7,160
  3. Avatar for Rexy 113. Rexy Lv 1 1 pt. 7,082
  4. Avatar for Adrian Leonardo Orjuela 114. Adrian Leonardo Orjuela Lv 1 1 pt. 7,017
  5. Avatar for Fernando18 115. Fernando18 Lv 1 1 pt. 6,996
  6. Avatar for abdulsahib 116. abdulsahib Lv 1 1 pt. 6,943
  7. Avatar for slee4970 117. slee4970 Lv 1 1 pt. 6,913
  8. Avatar for lickington 118. lickington Lv 1 1 pt. 6,896
  9. Avatar for 01010011111 119. 01010011111 Lv 1 1 pt. 6,646
  10. Avatar for YutiVaghela 120. YutiVaghela Lv 1 1 pt. 6,639

Comments