Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932
  1. Avatar for antibioticgel 111. antibioticgel Lv 1 1 pt. 7,202
  2. Avatar for Bufur 112. Bufur Lv 1 1 pt. 7,160
  3. Avatar for Rexy 113. Rexy Lv 1 1 pt. 7,082
  4. Avatar for Adrian Leonardo Orjuela 114. Adrian Leonardo Orjuela Lv 1 1 pt. 7,017
  5. Avatar for Fernando18 115. Fernando18 Lv 1 1 pt. 6,996
  6. Avatar for abdulsahib 116. abdulsahib Lv 1 1 pt. 6,943
  7. Avatar for slee4970 117. slee4970 Lv 1 1 pt. 6,913
  8. Avatar for lickington 118. lickington Lv 1 1 pt. 6,896
  9. Avatar for 01010011111 119. 01010011111 Lv 1 1 pt. 6,646
  10. Avatar for YutiVaghela 120. YutiVaghela Lv 1 1 pt. 6,639

Comments