Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,634
  2. Avatar for Czech National Team 12. Czech National Team 4 pts. 8,618
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 8,463
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,281
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,180
  6. Avatar for Eastern Prehistoric Force 16. Eastern Prehistoric Force 1 pt. 7,591
  7. Avatar for CH362_ButlerUniversity 17. CH362_ButlerUniversity 1 pt. 7,390
  8. Avatar for BT21s 18. BT21s 1 pt. 7,304
  9. Avatar for Team China 19. Team China 1 pt. 6,737
  10. Avatar for Window Group 20. Window Group 1 pt. 6,147
  1. Avatar for vrinda.gupta 131. vrinda.gupta Lv 1 1 pt. 7,417
  2. Avatar for jonvore 132. jonvore Lv 1 1 pt. 7,390
  3. Avatar for Watcharapon.pho 133. Watcharapon.pho Lv 1 1 pt. 7,379
  4. Avatar for furi0us 134. furi0us Lv 1 1 pt. 7,373
  5. Avatar for deathbat_87 135. deathbat_87 Lv 1 1 pt. 7,373
  6. Avatar for warumporn 136. warumporn Lv 1 1 pt. 7,373
  7. Avatar for sed4906 137. sed4906 Lv 1 1 pt. 7,359
  8. Avatar for Tonzi 138. Tonzi Lv 1 1 pt. 7,326
  9. Avatar for PhilipS 139. PhilipS Lv 1 1 pt. 7,304
  10. Avatar for Kingsleyh 140. Kingsleyh Lv 1 1 pt. 7,304

Comments