Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,634
  2. Avatar for Czech National Team 12. Czech National Team 4 pts. 8,618
  3. Avatar for SETI.Germany 13. SETI.Germany 2 pts. 8,463
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,281
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,180
  6. Avatar for Eastern Prehistoric Force 16. Eastern Prehistoric Force 1 pt. 7,591
  7. Avatar for CH362_ButlerUniversity 17. CH362_ButlerUniversity 1 pt. 7,390
  8. Avatar for BT21s 18. BT21s 1 pt. 7,304
  9. Avatar for Team China 19. Team China 1 pt. 6,737
  10. Avatar for Window Group 20. Window Group 1 pt. 6,147
  1. Avatar for Lotus23 31. Lotus23 Lv 1 37 pts. 9,467
  2. Avatar for akaaka 32. akaaka Lv 1 36 pts. 9,463
  3. Avatar for NeLikomSheet 33. NeLikomSheet Lv 1 35 pts. 9,457
  4. Avatar for Deleted player 34. Deleted player pts. 9,438
  5. Avatar for phi16 35. phi16 Lv 1 32 pts. 9,418
  6. Avatar for Maerlyn138 36. Maerlyn138 Lv 1 31 pts. 9,395
  7. Avatar for infjamc 37. infjamc Lv 1 30 pts. 9,390
  8. Avatar for alcor29 38. alcor29 Lv 1 29 pts. 9,359
  9. Avatar for blazegeek 39. blazegeek Lv 1 28 pts. 9,341
  10. Avatar for manu8170 40. manu8170 Lv 1 27 pts. 9,338

Comments