Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,892
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 9,875
  3. Avatar for Contenders 3. Contenders 63 pts. 9,830
  4. Avatar for Go Science 4. Go Science 49 pts. 9,806
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,759
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,636
  7. Avatar for Marvin's bunch 7. Marvin's bunch 21 pts. 9,633
  8. Avatar for Australia 8. Australia 15 pts. 8,995
  9. Avatar for Ogre's lab 9. Ogre's lab 11 pts. 8,935
  10. Avatar for AlphaFold 10. AlphaFold 8 pts. 8,691
  1. Avatar for Lotus23 31. Lotus23 Lv 1 37 pts. 9,467
  2. Avatar for akaaka 32. akaaka Lv 1 36 pts. 9,463
  3. Avatar for NeLikomSheet 33. NeLikomSheet Lv 1 35 pts. 9,457
  4. Avatar for Deleted player 34. Deleted player pts. 9,438
  5. Avatar for phi16 35. phi16 Lv 1 32 pts. 9,418
  6. Avatar for Maerlyn138 36. Maerlyn138 Lv 1 31 pts. 9,395
  7. Avatar for infjamc 37. infjamc Lv 1 30 pts. 9,390
  8. Avatar for alcor29 38. alcor29 Lv 1 29 pts. 9,359
  9. Avatar for blazegeek 39. blazegeek Lv 1 28 pts. 9,341
  10. Avatar for manu8170 40. manu8170 Lv 1 27 pts. 9,338

Comments