Placeholder image of a protein
Icon representing a puzzle

2051: Revisiting Puzzle 84: Giant Anemone

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
September 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,892
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 9,875
  3. Avatar for Contenders 3. Contenders 63 pts. 9,830
  4. Avatar for Go Science 4. Go Science 49 pts. 9,806
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,759
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,636
  7. Avatar for Marvin's bunch 7. Marvin's bunch 21 pts. 9,633
  8. Avatar for Australia 8. Australia 15 pts. 8,995
  9. Avatar for Ogre's lab 9. Ogre's lab 11 pts. 8,935
  10. Avatar for AlphaFold 10. AlphaFold 8 pts. 8,691
  1. Avatar for WBarme1234 51. WBarme1234 Lv 1 17 pts. 9,062
  2. Avatar for AlkiP0Ps 52. AlkiP0Ps Lv 1 16 pts. 8,995
  3. Avatar for bamh 53. bamh Lv 1 16 pts. 8,994
  4. Avatar for Merf 54. Merf Lv 1 15 pts. 8,990
  5. Avatar for rezaefar 55. rezaefar Lv 1 14 pts. 8,956
  6. Avatar for Deet 56. Deet Lv 1 14 pts. 8,956
  7. Avatar for Borets 57. Borets Lv 1 13 pts. 8,935
  8. Avatar for Todd6485577 58. Todd6485577 Lv 1 13 pts. 8,935
  9. Avatar for zackallen 59. zackallen Lv 1 12 pts. 8,923
  10. Avatar for kentish_alex 60. kentish_alex Lv 1 12 pts. 8,913

Comments