Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,907
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,825
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,588
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,969
  5. Avatar for Window Group 15. Window Group 1 pt. 6,616
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 4,300
  1. Avatar for HuubR 91. HuubR Lv 1 1 pt. 8,449
  2. Avatar for Noodle Soup 92. Noodle Soup Lv 1 1 pt. 8,438
  3. Avatar for frostschutz 93. frostschutz Lv 1 1 pt. 8,438
  4. Avatar for abiogenesis 94. abiogenesis Lv 1 1 pt. 8,434
  5. Avatar for carxo 95. carxo Lv 1 1 pt. 8,427
  6. Avatar for jsfoldingaccount 96. jsfoldingaccount Lv 1 1 pt. 8,369
  7. Avatar for jawz101 97. jawz101 Lv 1 1 pt. 8,331
  8. Avatar for Monte Bioinfo 98. Monte Bioinfo Lv 1 1 pt. 8,276
  9. Avatar for pascal ochem 99. pascal ochem Lv 1 1 pt. 8,218
  10. Avatar for Lpnt 100. Lpnt Lv 1 1 pt. 8,170

Comments