Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,907
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,825
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,588
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,969
  5. Avatar for Window Group 15. Window Group 1 pt. 6,616
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 4,300
  1. Avatar for andresesuarezj 111. andresesuarezj Lv 1 1 pt. 7,868
  2. Avatar for Julianarturoc 112. Julianarturoc Lv 1 1 pt. 7,850
  3. Avatar for gdnskye 113. gdnskye Lv 1 1 pt. 7,725
  4. Avatar for El_Muchacho 114. El_Muchacho Lv 1 1 pt. 7,713
  5. Avatar for ploypailin sangthong 115. ploypailin sangthong Lv 1 1 pt. 7,623
  6. Avatar for CarmeLow 116. CarmeLow Lv 1 1 pt. 7,600
  7. Avatar for ejacobs5 117. ejacobs5 Lv 1 1 pt. 7,546
  8. Avatar for patinok 118. patinok Lv 1 1 pt. 7,517
  9. Avatar for Mishail919 119. Mishail919 Lv 1 1 pt. 7,355
  10. Avatar for rmoretti 120. rmoretti Lv 1 1 pt. 6,969

Comments