Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,907
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,825
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,588
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,969
  5. Avatar for Window Group 15. Window Group 1 pt. 6,616
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 4,300
  1. Avatar for xythus 11. xythus Lv 1 69 pts. 9,733
  2. Avatar for Enzyme 12. Enzyme Lv 1 66 pts. 9,689
  3. Avatar for georg137 13. georg137 Lv 1 64 pts. 9,683
  4. Avatar for g_b 14. g_b Lv 1 61 pts. 9,674
  5. Avatar for jobo0502 15. jobo0502 Lv 1 59 pts. 9,671
  6. Avatar for NPrincipi 16. NPrincipi Lv 1 56 pts. 9,670
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 54 pts. 9,665
  8. Avatar for Lotus23 18. Lotus23 Lv 1 52 pts. 9,662
  9. Avatar for silent gene 19. silent gene Lv 1 50 pts. 9,642
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 48 pts. 9,633

Comments