Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,907
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,825
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,588
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,969
  5. Avatar for Window Group 15. Window Group 1 pt. 6,616
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 4,300
  1. Avatar for gmn 21. gmn Lv 1 46 pts. 9,612
  2. Avatar for robgee 22. robgee Lv 1 44 pts. 9,599
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 42 pts. 9,579
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 40 pts. 9,568
  5. Avatar for fiendish_ghoul 25. fiendish_ghoul Lv 1 38 pts. 9,566
  6. Avatar for blazegeek 26. blazegeek Lv 1 37 pts. 9,563
  7. Avatar for Skippysk8s 27. Skippysk8s Lv 1 35 pts. 9,562
  8. Avatar for frood66 28. frood66 Lv 1 34 pts. 9,557
  9. Avatar for borattt 29. borattt Lv 1 32 pts. 9,552
  10. Avatar for Deleted player 30. Deleted player pts. 9,548

Comments