Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,907
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,825
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,588
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,969
  5. Avatar for Window Group 15. Window Group 1 pt. 6,616
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 4,300
  1. Avatar for fishercat 51. fishercat Lv 1 11 pts. 9,207
  2. Avatar for Arne Heessels 52. Arne Heessels Lv 1 10 pts. 9,206
  3. Avatar for Alistair69 53. Alistair69 Lv 1 9 pts. 9,205
  4. Avatar for PeterDav 54. PeterDav Lv 1 9 pts. 9,186
  5. Avatar for equilibria 55. equilibria Lv 1 8 pts. 9,185
  6. Avatar for Todd6485577 56. Todd6485577 Lv 1 8 pts. 9,169
  7. Avatar for Beany 57. Beany Lv 1 8 pts. 9,162
  8. Avatar for heather-1 58. heather-1 Lv 1 7 pts. 9,154
  9. Avatar for zippyc137 59. zippyc137 Lv 1 7 pts. 9,153
  10. Avatar for AlkiP0Ps 60. AlkiP0Ps Lv 1 6 pts. 9,132

Comments