Placeholder image of a protein
Icon representing a puzzle

2054: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 07, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,907
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,825
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,588
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,969
  5. Avatar for Window Group 15. Window Group 1 pt. 6,616
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 4,300
  1. Avatar for DScott 61. DScott Lv 1 6 pts. 9,121
  2. Avatar for karmakazee 62. karmakazee Lv 1 6 pts. 9,100
  3. Avatar for Oransche 63. Oransche Lv 1 5 pts. 9,086
  4. Avatar for Trajan464 64. Trajan464 Lv 1 5 pts. 9,083
  5. Avatar for phi16 65. phi16 Lv 1 5 pts. 9,074
  6. Avatar for ProfVince 66. ProfVince Lv 1 4 pts. 9,059
  7. Avatar for Dr.Sillem 67. Dr.Sillem Lv 1 4 pts. 9,031
  8. Avatar for Deleted player 68. Deleted player 4 pts. 9,029
  9. Avatar for Hellcat6 69. Hellcat6 Lv 1 4 pts. 9,018
  10. Avatar for BassPlayer 70. BassPlayer Lv 1 3 pts. 8,982

Comments