Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,783
  2. Avatar for :) 12. :) 1 pt. 8,394
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,007
  4. Avatar for Kotocycle 14. Kotocycle 1 pt. 7,778
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,313
  6. Avatar for UPJ Biochem 25 16. UPJ Biochem 25 1 pt. 4,094
  1. Avatar for maojiangfeng 111. maojiangfeng Lv 1 1 pt. 7,710
  2. Avatar for Szj 112. Szj Lv 1 1 pt. 7,663
  3. Avatar for fabiodavilla 113. fabiodavilla Lv 1 1 pt. 7,662
  4. Avatar for ateeb 114. ateeb Lv 1 1 pt. 7,653
  5. Avatar for PetraPan17 115. PetraPan17 Lv 1 1 pt. 7,641
  6. Avatar for vbeator 116. vbeator Lv 1 1 pt. 7,510
  7. Avatar for HMK 117. HMK Lv 1 1 pt. 7,415
  8. Avatar for ThElektro 118. ThElektro Lv 1 1 pt. 7,411
  9. Avatar for Glitchlord 119. Glitchlord Lv 1 1 pt. 7,323
  10. Avatar for Yuan Ivycy 120. Yuan Ivycy Lv 1 1 pt. 7,306

Comments