Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,783
  2. Avatar for :) 12. :) 1 pt. 8,394
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,007
  4. Avatar for Kotocycle 14. Kotocycle 1 pt. 7,778
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,313
  6. Avatar for UPJ Biochem 25 16. UPJ Biochem 25 1 pt. 4,094

  1. Avatar for fiendish_ghoul 131. fiendish_ghoul Lv 1 1 pt. 4,094
  2. Avatar for Dr RAS 132. Dr RAS Lv 1 1 pt. 4,094
  3. Avatar for lansefeixue 133. lansefeixue Lv 1 1 pt. 4,094
  4. Avatar for newge21 134. newge21 Lv 1 1 pt. 4,094
  5. Avatar for puxatudo 135. puxatudo Lv 1 1 pt. 4,094
  6. Avatar for Sciren 136. Sciren Lv 1 1 pt. 4,094
  7. Avatar for Xiaoyou 137. Xiaoyou Lv 1 1 pt. 4,094
  8. Avatar for pauldunn 138. pauldunn Lv 1 1 pt. 4,094

Comments