Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,783
  2. Avatar for :) 12. :) 1 pt. 8,394
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,007
  4. Avatar for Kotocycle 14. Kotocycle 1 pt. 7,778
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,313
  6. Avatar for UPJ Biochem 25 16. UPJ Biochem 25 1 pt. 4,094
  1. Avatar for BarrySampson 31. BarrySampson Lv 1 30 pts. 10,422
  2. Avatar for BassPlayer 32. BassPlayer Lv 1 28 pts. 10,377
  3. Avatar for Maerlyn138 33. Maerlyn138 Lv 1 27 pts. 10,307
  4. Avatar for Pazithi 34. Pazithi Lv 1 26 pts. 10,219
  5. Avatar for fpc 35. fpc Lv 1 25 pts. 10,216
  6. Avatar for WBarme1234 36. WBarme1234 Lv 1 23 pts. 10,202
  7. Avatar for manu8170 37. manu8170 Lv 1 22 pts. 10,196
  8. Avatar for ProfVince 38. ProfVince Lv 1 21 pts. 10,188
  9. Avatar for akaaka 39. akaaka Lv 1 20 pts. 10,159
  10. Avatar for NPrincipi 40. NPrincipi Lv 1 19 pts. 10,115

Comments