Placeholder image of a protein
Icon representing a puzzle

2057: Revisiting Puzzle 86: Nematode

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 14, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,783
  2. Avatar for :) 12. :) 1 pt. 8,394
  3. Avatar for Ogre's lab 13. Ogre's lab 1 pt. 8,007
  4. Avatar for Kotocycle 14. Kotocycle 1 pt. 7,778
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,313
  6. Avatar for UPJ Biochem 25 16. UPJ Biochem 25 1 pt. 4,094
  1. Avatar for pascal ochem 81. pascal ochem Lv 1 2 pts. 8,570
  2. Avatar for deadmanday 82. deadmanday Lv 1 2 pts. 8,517
  3. Avatar for Mohoernchen 83. Mohoernchen Lv 1 2 pts. 8,515
  4. Avatar for hada 84. hada Lv 1 1 pt. 8,487
  5. Avatar for tracybutt 85. tracybutt Lv 1 1 pt. 8,418
  6. Avatar for machinelves 86. machinelves Lv 1 1 pt. 8,394
  7. Avatar for equilibria 87. equilibria Lv 1 1 pt. 8,393
  8. Avatar for bitwave 88. bitwave Lv 1 1 pt. 8,341
  9. Avatar for Zeng Jiong 89. Zeng Jiong Lv 1 1 pt. 8,300
  10. Avatar for Enzyme 90. Enzyme Lv 1 1 pt. 8,283

Comments