Placeholder image of a protein
Icon representing a puzzle

2060: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 21, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 8,657
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 8,587
  3. Avatar for :) 13. :) 1 pt. 8,243
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,238
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 7,263
  6. Avatar for Window Group 16. Window Group 1 pt. 6,852
  7. Avatar for UPJ Biochem 25 17. UPJ Biochem 25 1 pt. 3,852

  1. Avatar for Savas 91. Savas Lv 1 1 pt. 8,238
  2. Avatar for Hellcat6 92. Hellcat6 Lv 1 1 pt. 8,212
  3. Avatar for Jenot96 93. Jenot96 Lv 1 1 pt. 8,171
  4. Avatar for carxo 94. carxo Lv 1 1 pt. 8,020
  5. Avatar for Mohoernchen 95. Mohoernchen Lv 1 1 pt. 8,017
  6. Avatar for gianbomb 96. gianbomb Lv 1 1 pt. 7,984
  7. Avatar for Stromkarls Zheng 97. Stromkarls Zheng Lv 1 1 pt. 7,898
  8. Avatar for pascal ochem 98. pascal ochem Lv 1 1 pt. 7,844
  9. Avatar for proteinfolderpro 99. proteinfolderpro Lv 1 1 pt. 7,792
  10. Avatar for kelez 100. kelez Lv 1 1 pt. 7,769

Comments