Placeholder image of a protein
Icon representing a puzzle

2060: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
October 21, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,119
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,113
  3. Avatar for Go Science 3. Go Science 52 pts. 9,096
  4. Avatar for Contenders 4. Contenders 36 pts. 9,053
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 9,014
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 8,993
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 8,867
  8. Avatar for AlphaFold 8. AlphaFold 6 pts. 8,822
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 8,777
  10. Avatar for Australia 10. Australia 2 pts. 8,748
  1. Avatar for Savas 91. Savas Lv 1 1 pt. 8,238
  2. Avatar for Hellcat6 92. Hellcat6 Lv 1 1 pt. 8,212
  3. Avatar for Jenot96 93. Jenot96 Lv 1 1 pt. 8,171
  4. Avatar for carxo 94. carxo Lv 1 1 pt. 8,020
  5. Avatar for Mohoernchen 95. Mohoernchen Lv 1 1 pt. 8,017
  6. Avatar for gianbomb 96. gianbomb Lv 1 1 pt. 7,984
  7. Avatar for Stromkarls Zheng 97. Stromkarls Zheng Lv 1 1 pt. 7,898
  8. Avatar for pascal ochem 98. pascal ochem Lv 1 1 pt. 7,844
  9. Avatar for proteinfolderpro 99. proteinfolderpro Lv 1 1 pt. 7,792
  10. Avatar for kelez 100. kelez Lv 1 1 pt. 7,769

Comments