Placeholder image of a protein
Icon representing a puzzle

2069: Revisiting Puzzle 89: Cow Eye

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 10,678
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,614
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,528
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,458
  5. Avatar for Window Group 15. Window Group 1 pt. 8,752
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,278
  1. Avatar for Cicadashell 91. Cicadashell Lv 1 1 pt. 10,102
  2. Avatar for Ib_hems 92. Ib_hems Lv 1 1 pt. 10,073
  3. Avatar for Mohoernchen 93. Mohoernchen Lv 1 1 pt. 10,047
  4. Avatar for papaya_rainbow 94. papaya_rainbow Lv 1 1 pt. 10,047
  5. Avatar for pascal ochem 95. pascal ochem Lv 1 1 pt. 10,041
  6. Avatar for Supanutfirst 96. Supanutfirst Lv 1 1 pt. 10,035
  7. Avatar for JustinRothganger 97. JustinRothganger Lv 1 1 pt. 10,016
  8. Avatar for LEELANA 98. LEELANA Lv 1 1 pt. 9,888
  9. Avatar for erikviking 99. erikviking Lv 1 1 pt. 9,883
  10. Avatar for JoyDK 100. JoyDK Lv 1 1 pt. 9,866

Comments