Placeholder image of a protein
Icon representing a puzzle

2069: Revisiting Puzzle 89: Cow Eye

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 10,678
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,614
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,528
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,458
  5. Avatar for Window Group 15. Window Group 1 pt. 8,752
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,278
  1. Avatar for Duangkamon 111. Duangkamon Lv 1 1 pt. 9,567
  2. Avatar for bruh_joe 112. bruh_joe Lv 1 1 pt. 9,502
  3. Avatar for AnaSikici 113. AnaSikici Lv 1 1 pt. 9,459
  4. Avatar for lynlee.thrasher 114. lynlee.thrasher Lv 1 1 pt. 9,402
  5. Avatar for ALiyA9 115. ALiyA9 Lv 1 1 pt. 9,362
  6. Avatar for DipsyDoodle2016 116. DipsyDoodle2016 Lv 1 1 pt. 9,340
  7. Avatar for bananapeanutbutter 117. bananapeanutbutter Lv 1 1 pt. 9,241
  8. Avatar for furi0us 118. furi0us Lv 1 1 pt. 9,230
  9. Avatar for Amphor 119. Amphor Lv 1 1 pt. 9,200
  10. Avatar for art1234 120. art1234 Lv 1 1 pt. 9,045

Comments