Placeholder image of a protein
Icon representing a puzzle

2069: Revisiting Puzzle 89: Cow Eye

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
November 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 10,678
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,614
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,528
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,458
  5. Avatar for Window Group 15. Window Group 1 pt. 8,752
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,278

  1. Avatar for mate10428 121. mate10428 Lv 1 1 pt. 8,859
  2. Avatar for jflat06 122. jflat06 Lv 1 1 pt. 8,752
  3. Avatar for tinobx 123. tinobx Lv 1 1 pt. 8,516
  4. Avatar for knec2359 124. knec2359 Lv 1 1 pt. 8,420
  5. Avatar for rmoretti 125. rmoretti Lv 1 1 pt. 8,278
  6. Avatar for mes0213 126. mes0213 Lv 1 1 pt. 8,182
  7. Avatar for bkoep 127. bkoep Lv 1 1 pt. 8,171
  8. Avatar for Rosa0311 128. Rosa0311 Lv 1 1 pt. 5,919
  9. Avatar for mojtabakiller 129. mojtabakiller Lv 1 1 pt. 5,139
  10. Avatar for Krieger1708 130. Krieger1708 Lv 1 1 pt. 4,662

Comments