Placeholder image of a protein
Icon representing a puzzle

2069: Revisiting Puzzle 89: Cow Eye

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 10,678
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,614
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,528
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,458
  5. Avatar for Window Group 15. Window Group 1 pt. 8,752
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,278
  1. Avatar for Maerlyn138 31. Maerlyn138 Lv 1 30 pts. 10,987
  2. Avatar for phi16 32. phi16 Lv 1 28 pts. 10,985
  3. Avatar for fishercat 33. fishercat Lv 1 27 pts. 10,981
  4. Avatar for manu8170 34. manu8170 Lv 1 26 pts. 10,977
  5. Avatar for jtrube1 35. jtrube1 Lv 1 25 pts. 10,973
  6. Avatar for kyoota 36. kyoota Lv 1 23 pts. 10,962
  7. Avatar for guineapig 37. guineapig Lv 1 22 pts. 10,954
  8. Avatar for drumpeter18yrs9yrs 38. drumpeter18yrs9yrs Lv 1 21 pts. 10,950
  9. Avatar for Alistair69 39. Alistair69 Lv 1 20 pts. 10,948
  10. Avatar for Oransche 40. Oransche Lv 1 19 pts. 10,936

Comments