Placeholder image of a protein
Icon representing a puzzle

2069: Revisiting Puzzle 89: Cow Eye

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 10,678
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,614
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,528
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,458
  5. Avatar for Window Group 15. Window Group 1 pt. 8,752
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,278
  1. Avatar for kentish_alex 51. kentish_alex Lv 1 11 pts. 10,802
  2. Avatar for ProfVince 52. ProfVince Lv 1 10 pts. 10,765
  3. Avatar for Wiz kid 53. Wiz kid Lv 1 10 pts. 10,748
  4. Avatar for fah le 54. fah le Lv 1 9 pts. 10,736
  5. Avatar for infjamc 55. infjamc Lv 1 9 pts. 10,715
  6. Avatar for cjddig 56. cjddig Lv 1 8 pts. 10,710
  7. Avatar for lraguette 57. lraguette Lv 1 8 pts. 10,709
  8. Avatar for pps.ou 58. pps.ou Lv 1 7 pts. 10,696
  9. Avatar for tracybutt 59. tracybutt Lv 1 7 pts. 10,694
  10. Avatar for Borets 60. Borets Lv 1 6 pts. 10,678

Comments