Placeholder image of a protein
Icon representing a puzzle

2069: Revisiting Puzzle 89: Cow Eye

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
November 11, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 10,678
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,614
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,528
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,458
  5. Avatar for Window Group 15. Window Group 1 pt. 8,752
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,278

  1. Avatar for ManVsYard 71. ManVsYard Lv 1 3 pts. 10,551
  2. Avatar for dahast.de 72. dahast.de Lv 1 3 pts. 10,528
  3. Avatar for zannipietro 73. zannipietro Lv 1 3 pts. 10,481
  4. Avatar for puxatudo 74. puxatudo Lv 1 3 pts. 10,471
  5. Avatar for SuperRainbowUnicorn 75. SuperRainbowUnicorn Lv 1 3 pts. 10,462
  6. Avatar for Simek 76. Simek Lv 1 2 pts. 10,458
  7. Avatar for DScott 77. DScott Lv 1 2 pts. 10,450
  8. Avatar for Larini 78. Larini Lv 1 2 pts. 10,444
  9. Avatar for Deleted player 79. Deleted player 2 pts. 10,351
  10. Avatar for BarrySampson 80. BarrySampson Lv 1 2 pts. 10,340

Comments