Placeholder image of a protein
Icon representing a puzzle

2072: Revisiting Puzzle 90: Heliomicin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
November 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,748
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,686
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,605
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,401
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,223

  1. Avatar for herve056 91. herve056 Lv 1 1 pt. 8,159
  2. Avatar for DipsyDoodle2016 92. DipsyDoodle2016 Lv 1 1 pt. 8,098
  3. Avatar for Cicadashell 93. Cicadashell Lv 1 1 pt. 8,097
  4. Avatar for DylanAAAaaa111 94. DylanAAAaaa111 Lv 1 1 pt. 8,086
  5. Avatar for antibot215 95. antibot215 Lv 1 1 pt. 8,073
  6. Avatar for multaq 96. multaq Lv 1 1 pt. 7,998
  7. Avatar for john-h-lecter 97. john-h-lecter Lv 1 1 pt. 7,970
  8. Avatar for huitgh 98. huitgh Lv 1 1 pt. 7,894
  9. Avatar for JoyDK 99. JoyDK Lv 1 1 pt. 7,831
  10. Avatar for Phobos009 100. Phobos009 Lv 1 1 pt. 7,799

Comments