Placeholder image of a protein
Icon representing a puzzle

2072: Revisiting Puzzle 90: Heliomicin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,748
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,686
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,605
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,401
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,223
  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 66 pts. 9,678
  2. Avatar for Deleted player 12. Deleted player pts. 9,675
  3. Avatar for frood66 13. frood66 Lv 1 61 pts. 9,674
  4. Avatar for grogar7 14. grogar7 Lv 1 58 pts. 9,669
  5. Avatar for Phyx 15. Phyx Lv 1 55 pts. 9,666
  6. Avatar for borattt 16. borattt Lv 1 53 pts. 9,656
  7. Avatar for jausmh 17. jausmh Lv 1 51 pts. 9,656
  8. Avatar for georg137 18. georg137 Lv 1 48 pts. 9,652
  9. Avatar for fiendish_ghoul 19. fiendish_ghoul Lv 1 46 pts. 9,626
  10. Avatar for szinr 20. szinr Lv 1 44 pts. 9,613

Comments