Placeholder image of a protein
Icon representing a puzzle

2072: Revisiting Puzzle 90: Heliomicin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,748
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,686
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,605
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,401
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,223
  1. Avatar for dcrwheeler 21. dcrwheeler Lv 1 42 pts. 9,603
  2. Avatar for manu8170 22. manu8170 Lv 1 40 pts. 9,603
  3. Avatar for silent gene 23. silent gene Lv 1 38 pts. 9,602
  4. Avatar for xythus 24. xythus Lv 1 36 pts. 9,591
  5. Avatar for Idiotboy 25. Idiotboy Lv 1 35 pts. 9,589
  6. Avatar for NeLikomSheet 26. NeLikomSheet Lv 1 33 pts. 9,578
  7. Avatar for akaaka 27. akaaka Lv 1 31 pts. 9,550
  8. Avatar for Vinara 28. Vinara Lv 1 30 pts. 9,546
  9. Avatar for Maerlyn138 29. Maerlyn138 Lv 1 28 pts. 9,522
  10. Avatar for Lotus23 30. Lotus23 Lv 1 27 pts. 9,517

Comments