Placeholder image of a protein
Icon representing a puzzle

2072: Revisiting Puzzle 90: Heliomicin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
November 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,748
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,686
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,605
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,401
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,223

  1. Avatar for bamh 41. bamh Lv 1 15 pts. 9,307
  2. Avatar for PeterDav 42. PeterDav Lv 1 14 pts. 9,300
  3. Avatar for infjamc 43. infjamc Lv 1 13 pts. 9,295
  4. Avatar for zippyc137 44. zippyc137 Lv 1 12 pts. 9,280
  5. Avatar for equilibria 45. equilibria Lv 1 12 pts. 9,258
  6. Avatar for ShadowTactics 46. ShadowTactics Lv 1 11 pts. 9,258
  7. Avatar for fpc 47. fpc Lv 1 10 pts. 9,219
  8. Avatar for argyrw 48. argyrw Lv 1 10 pts. 9,184
  9. Avatar for maithra 49. maithra Lv 1 9 pts. 9,177
  10. Avatar for CharaLilith 50. CharaLilith Lv 1 9 pts. 9,171

Comments