Placeholder image of a protein
Icon representing a puzzle

2072: Revisiting Puzzle 90: Heliomicin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,748
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,686
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,605
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,401
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,223
  1. Avatar for alcor29 51. alcor29 Lv 1 8 pts. 9,169
  2. Avatar for heather-1 52. heather-1 Lv 1 8 pts. 9,107
  3. Avatar for cjddig 53. cjddig Lv 1 7 pts. 9,088
  4. Avatar for NPrincipi 54. NPrincipi Lv 1 7 pts. 9,084
  5. Avatar for Larini 55. Larini Lv 1 6 pts. 9,062
  6. Avatar for Alistair69 56. Alistair69 Lv 1 6 pts. 9,030
  7. Avatar for kentish_alex 57. kentish_alex Lv 1 5 pts. 9,025
  8. Avatar for Hellcat6 58. Hellcat6 Lv 1 5 pts. 9,023
  9. Avatar for ucad 59. ucad Lv 1 5 pts. 8,993
  10. Avatar for tracybutt 60. tracybutt Lv 1 4 pts. 8,985

Comments