Placeholder image of a protein
Icon representing a puzzle

2072: Revisiting Puzzle 90: Heliomicin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,748
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,686
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,605
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,401
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,223
  1. Avatar for kyoota 61. kyoota Lv 1 4 pts. 8,965
  2. Avatar for fishercat 62. fishercat Lv 1 4 pts. 8,929
  3. Avatar for zackallen 63. zackallen Lv 1 4 pts. 8,918
  4. Avatar for drumpeter18yrs9yrs 64. drumpeter18yrs9yrs Lv 1 3 pts. 8,868
  5. Avatar for Arne Heessels 65. Arne Heessels Lv 1 3 pts. 8,857
  6. Avatar for zannipietro 66. zannipietro Lv 1 3 pts. 8,755
  7. Avatar for Todd6485577 67. Todd6485577 Lv 1 3 pts. 8,752
  8. Avatar for vybi 68. vybi Lv 1 3 pts. 8,748
  9. Avatar for Wiz kid 69. Wiz kid Lv 1 2 pts. 8,710
  10. Avatar for Mohoernchen 70. Mohoernchen Lv 1 2 pts. 8,699

Comments