Placeholder image of a protein
Icon representing a puzzle

2072: Revisiting Puzzle 90: Heliomicin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
November 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 1 pt. 8,748
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,686
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,605
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,401
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,223

  1. Avatar for rinze 81. rinze Lv 1 1 pt. 8,407
  2. Avatar for Savas 82. Savas Lv 1 1 pt. 8,401
  3. Avatar for Pibeagles1 83. Pibeagles1 Lv 1 1 pt. 8,387
  4. Avatar for abiogenesis 84. abiogenesis Lv 1 1 pt. 8,385
  5. Avatar for Alex333 85. Alex333 Lv 1 1 pt. 8,344
  6. Avatar for north_zephyr 86. north_zephyr Lv 1 1 pt. 8,323
  7. Avatar for heyubob 87. heyubob Lv 1 1 pt. 8,300
  8. Avatar for JustinRothganger 88. JustinRothganger Lv 1 1 pt. 8,241
  9. Avatar for Sciren 89. Sciren Lv 1 1 pt. 8,223
  10. Avatar for Mr.Fish3474 90. Mr.Fish3474 Lv 1 1 pt. 8,185

Comments