Placeholder image of a protein
Icon representing a puzzle

2072: Revisiting Puzzle 90: Heliomicin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,789
  2. Avatar for Go Science 2. Go Science 70 pts. 9,786
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,748
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,720
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 9,704
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 9,674
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,613
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,445
  9. Avatar for Australia 9. Australia 2 pts. 9,393
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,258
  1. Avatar for gmn 31. gmn Lv 1 26 pts. 9,501
  2. Avatar for robgee 32. robgee Lv 1 24 pts. 9,487
  3. Avatar for Skippysk8s 33. Skippysk8s Lv 1 23 pts. 9,482
  4. Avatar for ProfVince 34. ProfVince Lv 1 22 pts. 9,469
  5. Avatar for Simek 35. Simek Lv 1 21 pts. 9,445
  6. Avatar for WBarme1234 36. WBarme1234 Lv 1 20 pts. 9,429
  7. Avatar for Deet 37. Deet Lv 1 19 pts. 9,421
  8. Avatar for AlkiP0Ps 38. AlkiP0Ps Lv 1 18 pts. 9,393
  9. Avatar for BarrySampson 39. BarrySampson Lv 1 17 pts. 9,331
  10. Avatar for phi16 40. phi16 Lv 1 16 pts. 9,331

Comments