Placeholder image of a protein
Icon representing a puzzle

2072: Revisiting Puzzle 90: Heliomicin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
November 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,789
  2. Avatar for Go Science 2. Go Science 70 pts. 9,786
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 9,748
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,720
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 9,704
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 9,674
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,613
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,445
  9. Avatar for Australia 9. Australia 2 pts. 9,393
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,258
  1. Avatar for AlphaFold2 71. AlphaFold2 Lv 1 2 pts. 8,686
  2. Avatar for Dr.Sillem 72. Dr.Sillem Lv 1 2 pts. 8,646
  3. Avatar for pfirth 73. pfirth Lv 1 2 pts. 8,621
  4. Avatar for Oransche 74. Oransche Lv 1 2 pts. 8,612
  5. Avatar for dahast.de 75. dahast.de Lv 1 2 pts. 8,605
  6. Avatar for rezaefar 76. rezaefar Lv 1 1 pt. 8,595
  7. Avatar for eusair 77. eusair Lv 1 1 pt. 8,577
  8. Avatar for DScott 78. DScott Lv 1 1 pt. 8,532
  9. Avatar for Trajan464 79. Trajan464 Lv 1 1 pt. 8,467
  10. Avatar for CAN1958 80. CAN1958 Lv 1 1 pt. 8,434

Comments