Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 8,488
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,415
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 7,998
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,603
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,509
  6. Avatar for StueveBio 16. StueveBio 1 pt. 5,875
  7. Avatar for Window Group 17. Window Group 1 pt. 5,610
  8. Avatar for test_group1 18. test_group1 1 pt. 668
  9. Avatar for Deleted group 19. Deleted group pts. 668
  1. Avatar for Thoy 121. Thoy Lv 1 1 pt. 6,820
  2. Avatar for tracybutt 122. tracybutt Lv 1 1 pt. 6,816
  3. Avatar for Cosmooo 123. Cosmooo Lv 1 1 pt. 6,807
  4. Avatar for nicobul 124. nicobul Lv 1 1 pt. 6,807
  5. Avatar for Deet 125. Deet Lv 1 1 pt. 6,802
  6. Avatar for kludbrook 126. kludbrook Lv 1 1 pt. 6,796
  7. Avatar for elcurrito 127. elcurrito Lv 1 1 pt. 6,777
  8. Avatar for Doomneator 128. Doomneator Lv 1 1 pt. 6,769
  9. Avatar for AleAyeye 129. AleAyeye Lv 1 1 pt. 6,749
  10. Avatar for amazzetti 130. amazzetti Lv 1 1 pt. 6,747

Comments