Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 8,488
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,415
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 7,998
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,603
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,509
  6. Avatar for StueveBio 16. StueveBio 1 pt. 5,875
  7. Avatar for Window Group 17. Window Group 1 pt. 5,610
  8. Avatar for test_group1 18. test_group1 1 pt. 668
  9. Avatar for Deleted group 19. Deleted group pts. 668

  1. Avatar for luishalf 151. luishalf Lv 1 1 pt. 5,625
  2. Avatar for jflat06 152. jflat06 Lv 1 1 pt. 5,610
  3. Avatar for Aniy 153. Aniy Lv 1 1 pt. 5,414
  4. Avatar for Daniela Aleja 154. Daniela Aleja Lv 1 1 pt. 5,334
  5. Avatar for Maerlyn138 155. Maerlyn138 Lv 1 1 pt. 5,071
  6. Avatar for Wapigamer 156. Wapigamer Lv 1 1 pt. 4,792
  7. Avatar for rmoretti 157. rmoretti Lv 1 1 pt. 4,388
  8. Avatar for opipapo 158. opipapo Lv 1 1 pt. 4,344
  9. Avatar for wjsthdmss 159. wjsthdmss Lv 1 1 pt. 4,318
  10. Avatar for George3551 160. George3551 Lv 1 1 pt. 4,283

Comments