Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 8,488
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,415
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 7,998
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,603
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,509
  6. Avatar for StueveBio 16. StueveBio 1 pt. 5,875
  7. Avatar for Window Group 17. Window Group 1 pt. 5,610
  8. Avatar for test_group1 18. test_group1 1 pt. 668
  9. Avatar for Deleted group 19. Deleted group pts. 668
  1. Avatar for Exonx 71. Exonx Lv 1 9 pts. 8,461
  2. Avatar for kentish_alex 72. kentish_alex Lv 1 9 pts. 8,446
  3. Avatar for zackallen 73. zackallen Lv 1 9 pts. 8,431
  4. Avatar for Dr.Sillem 74. Dr.Sillem Lv 1 8 pts. 8,419
  5. Avatar for vuvuvu 75. vuvuvu Lv 1 8 pts. 8,415
  6. Avatar for Trajan464 76. Trajan464 Lv 1 8 pts. 8,316
  7. Avatar for antibot215 77. antibot215 Lv 1 7 pts. 8,284
  8. Avatar for rezaefar 78. rezaefar Lv 1 7 pts. 8,259
  9. Avatar for Wiz kid 79. Wiz kid Lv 1 7 pts. 8,253
  10. Avatar for zannipietro 80. zannipietro Lv 1 6 pts. 8,251

Comments