Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,963
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 9,934
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,878
  4. Avatar for Go Science 4. Go Science 41 pts. 9,818
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 9,786
  6. Avatar for Contenders 6. Contenders 20 pts. 9,759
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 9,718
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,186
  9. Avatar for AlphaFold 9. AlphaFold 6 pts. 8,865
  10. Avatar for Australia 10. Australia 4 pts. 8,851
  1. Avatar for mceyoya 161. mceyoya Lv 1 1 pt. 4,230
  2. Avatar for Nan4sh1 162. Nan4sh1 Lv 1 1 pt. 4,220
  3. Avatar for m4tb4di 163. m4tb4di Lv 1 1 pt. 4,195
  4. Avatar for AlejandroMorales 164. AlejandroMorales Lv 1 1 pt. 3,946
  5. Avatar for TOLOMEO_s 165. TOLOMEO_s Lv 1 1 pt. 3,913
  6. Avatar for uhapko 166. uhapko Lv 1 1 pt. 3,901
  7. Avatar for Remug 167. Remug Lv 1 1 pt. 3,867
  8. Avatar for Xerxes678 168. Xerxes678 Lv 1 1 pt. 3,123
  9. Avatar for Humanator 169. Humanator Lv 1 1 pt. 2,849
  10. Avatar for r.g.t 170. r.g.t Lv 1 1 pt. 2,750

Comments