Placeholder image of a protein
Icon representing a puzzle

2080: Revisiting Puzzle 93: Spider Toxin

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 09, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small toxin is produced from the funnel-web spider A. aperta, and induces paralysis in insects by blocking calcium channels. This protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:

KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,963
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 9,934
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,878
  4. Avatar for Go Science 4. Go Science 41 pts. 9,818
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 9,786
  6. Avatar for Contenders 6. Contenders 20 pts. 9,759
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 9,718
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,186
  9. Avatar for AlphaFold 9. AlphaFold 6 pts. 8,865
  10. Avatar for Australia 10. Australia 4 pts. 8,851
  1. Avatar for 34toco 141. 34toco Lv 1 1 pt. 6,429
  2. Avatar for harvardman 142. harvardman Lv 1 1 pt. 6,383
  3. Avatar for Alejandro3213 143. Alejandro3213 Lv 1 1 pt. 6,380
  4. Avatar for Jonnatan Avi 144. Jonnatan Avi Lv 1 1 pt. 6,377
  5. Avatar for Vicente23 145. Vicente23 Lv 1 1 pt. 6,370
  6. Avatar for leonelzxc 146. leonelzxc Lv 1 1 pt. 6,348
  7. Avatar for elkorbo 147. elkorbo Lv 1 1 pt. 6,110
  8. Avatar for Kraqun 148. Kraqun Lv 1 1 pt. 5,995
  9. Avatar for haneol yang 149. haneol yang Lv 1 1 pt. 5,875
  10. Avatar for Anson_69 150. Anson_69 Lv 1 1 pt. 5,638

Comments