Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Beta Folders 100 pts. 10,746
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 10,725
  3. Avatar for Go Science 3. Go Science 56 pts. 10,703
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,694
  5. Avatar for Contenders 5. Contenders 29 pts. 10,628
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 10,509
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,485
  8. Avatar for AlphaFold 8. AlphaFold 9 pts. 10,413
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 10,360
  10. Avatar for foldeRNA 10. foldeRNA 4 pts. 10,301

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,746
  2. Avatar for frood66 2. frood66 Lv 1 98 pts. 10,681
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 95 pts. 10,679
  4. Avatar for gmn 4. gmn Lv 1 92 pts. 10,667
  5. Avatar for Arthuriel 5. Arthuriel Lv 1 89 pts. 10,630
  6. Avatar for Bletchley Park 6. Bletchley Park Lv 1 87 pts. 10,628
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 84 pts. 10,591
  8. Avatar for BootsMcGraw 8. BootsMcGraw Lv 1 81 pts. 10,588
  9. Avatar for grogar7 9. grogar7 Lv 1 79 pts. 10,581
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 77 pts. 10,552

Comments