Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Australia 11. Australia 2 pts. 10,084
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,074
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,757
  4. Avatar for Russian team 14. Russian team 1 pt. 9,747
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,615
  6. Avatar for Team China 16. Team China 1 pt. 9,522
  7. Avatar for Team Canada 17. Team Canada 1 pt. 8,962
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 8,857
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,241
  1. Avatar for Devilbloody 91. Devilbloody Lv 1 3 pts. 9,477
  2. Avatar for LPOy 92. LPOy Lv 1 3 pts. 9,458
  3. Avatar for JuleMag 93. JuleMag Lv 1 2 pts. 9,447
  4. Avatar for GOZ1N 94. GOZ1N Lv 1 2 pts. 9,415
  5. Avatar for soquasi 95. soquasi Lv 1 2 pts. 9,395
  6. Avatar for doakify 96. doakify Lv 1 2 pts. 9,392
  7. Avatar for Tolaymat 97. Tolaymat Lv 1 2 pts. 9,364
  8. Avatar for antibot215 98. antibot215 Lv 1 2 pts. 9,345
  9. Avatar for maxi369 99. maxi369 Lv 1 2 pts. 9,342
  10. Avatar for lionheart99 100. lionheart99 Lv 1 2 pts. 9,311

Comments