Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Australia 11. Australia 2 pts. 10,084
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,074
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,757
  4. Avatar for Russian team 14. Russian team 1 pt. 9,747
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,615
  6. Avatar for Team China 16. Team China 1 pt. 9,522
  7. Avatar for Team Canada 17. Team Canada 1 pt. 8,962
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 8,857
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,241
  1. Avatar for Pgmezcua 101. Pgmezcua Lv 1 2 pts. 9,305
  2. Avatar for LELE1964 102. LELE1964 Lv 1 2 pts. 9,255
  3. Avatar for Amynet 103. Amynet Lv 1 1 pt. 9,238
  4. Avatar for Hiaci 104. Hiaci Lv 1 1 pt. 9,237
  5. Avatar for ManVsYard 105. ManVsYard Lv 1 1 pt. 9,226
  6. Avatar for Beany 106. Beany Lv 1 1 pt. 9,218
  7. Avatar for Mohoernchen 107. Mohoernchen Lv 1 1 pt. 9,174
  8. Avatar for mateofoldit 108. mateofoldit Lv 1 1 pt. 9,172
  9. Avatar for jaejae54 109. jaejae54 Lv 1 1 pt. 9,169
  10. Avatar for guilherme_paredes 110. guilherme_paredes Lv 1 1 pt. 9,148

Comments