Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Australia 11. Australia 2 pts. 10,084
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,074
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,757
  4. Avatar for Russian team 14. Russian team 1 pt. 9,747
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,615
  6. Avatar for Team China 16. Team China 1 pt. 9,522
  7. Avatar for Team Canada 17. Team Canada 1 pt. 8,962
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 8,857
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,241

  1. Avatar for ROOZEBOOM 111. ROOZEBOOM Lv 1 1 pt. 9,124
  2. Avatar for creativspelerr 112. creativspelerr Lv 1 1 pt. 9,069
  3. Avatar for Merf 113. Merf Lv 1 1 pt. 9,050
  4. Avatar for OperatorOrville 114. OperatorOrville Lv 1 1 pt. 9,047
  5. Avatar for Optime 115. Optime Lv 1 1 pt. 9,024
  6. Avatar for mart0258 116. mart0258 Lv 1 1 pt. 8,998
  7. Avatar for Xmat 117. Xmat Lv 1 1 pt. 8,978
  8. Avatar for Bearpaw 118. Bearpaw Lv 1 1 pt. 8,962
  9. Avatar for Endirium 119. Endirium Lv 1 1 pt. 8,960
  10. Avatar for furi0us 120. furi0us Lv 1 1 pt. 8,958

Comments