Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Australia 11. Australia 2 pts. 10,084
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,074
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,757
  4. Avatar for Russian team 14. Russian team 1 pt. 9,747
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,615
  6. Avatar for Team China 16. Team China 1 pt. 9,522
  7. Avatar for Team Canada 17. Team Canada 1 pt. 8,962
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 8,857
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,241

  1. Avatar for aarbag 121. aarbag Lv 1 1 pt. 8,902
  2. Avatar for alyssa_d_V2.0 122. alyssa_d_V2.0 Lv 1 1 pt. 8,857
  3. Avatar for Chemist23 123. Chemist23 Lv 1 1 pt. 8,827
  4. Avatar for takumi555 124. takumi555 Lv 1 1 pt. 8,750
  5. Avatar for SKAT1997 125. SKAT1997 Lv 1 1 pt. 8,651
  6. Avatar for adam753 126. adam753 Lv 1 1 pt. 8,531
  7. Avatar for angelcienstxd1 127. angelcienstxd1 Lv 1 1 pt. 8,397
  8. Avatar for BJM918 128. BJM918 Lv 1 1 pt. 8,374
  9. Avatar for Woolier Brooks 129. Woolier Brooks Lv 1 1 pt. 8,321
  10. Avatar for akeane22 130. akeane22 Lv 1 1 pt. 8,270

Comments