Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Australia 11. Australia 2 pts. 10,084
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,074
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,757
  4. Avatar for Russian team 14. Russian team 1 pt. 9,747
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,615
  6. Avatar for Team China 16. Team China 1 pt. 9,522
  7. Avatar for Team Canada 17. Team Canada 1 pt. 8,962
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 8,857
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,241

  1. Avatar for MrBurns 131. MrBurns Lv 1 1 pt. 8,245
  2. Avatar for multaq 132. multaq Lv 1 1 pt. 8,242
  3. Avatar for 01010011111 133. 01010011111 Lv 1 1 pt. 8,231
  4. Avatar for Pythoness 134. Pythoness Lv 1 1 pt. 8,205
  5. Avatar for Cristian_01 135. Cristian_01 Lv 1 1 pt. 8,197
  6. Avatar for omareado 136. omareado Lv 1 1 pt. 8,166
  7. Avatar for sebastian01 137. sebastian01 Lv 1 1 pt. 7,947
  8. Avatar for Sciren 138. Sciren Lv 1 1 pt. 7,241
  9. Avatar for jirwaxu 140. jirwaxu Lv 1 1 pt. 7,169

Comments