Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Australia 11. Australia 2 pts. 10,084
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,074
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,757
  4. Avatar for Russian team 14. Russian team 1 pt. 9,747
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,615
  6. Avatar for Team China 16. Team China 1 pt. 9,522
  7. Avatar for Team Canada 17. Team Canada 1 pt. 8,962
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 8,857
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,241

  1. Avatar for Infraksvolt 141. Infraksvolt Lv 1 1 pt. 6,946
  2. Avatar for asdf1290 142. asdf1290 Lv 1 1 pt. 6,575
  3. Avatar for cesarz2012 143. cesarz2012 Lv 1 1 pt. 6,303
  4. Avatar for Karmencek17 144. Karmencek17 Lv 1 1 pt. 6,211
  5. Avatar for Viliano 145. Viliano Lv 1 1 pt. 6,030
  6. Avatar for jpipol 146. jpipol Lv 1 1 pt. 5,976
  7. Avatar for Arra_Elaine_Einar 147. Arra_Elaine_Einar Lv 1 1 pt. 5,908
  8. Avatar for MasterRuh 148. MasterRuh Lv 1 1 pt. 5,886
  9. Avatar for giacomom 149. giacomom Lv 1 1 pt. 5,596
  10. Avatar for pleple 150. pleple Lv 1 1 pt. 5,420

Comments