Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Australia 11. Australia 2 pts. 10,084
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,074
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,757
  4. Avatar for Russian team 14. Russian team 1 pt. 9,747
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,615
  6. Avatar for Team China 16. Team China 1 pt. 9,522
  7. Avatar for Team Canada 17. Team Canada 1 pt. 8,962
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 8,857
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,241
  1. Avatar for g_b 21. g_b Lv 1 54 pts. 10,501
  2. Avatar for Skippysk8s 22. Skippysk8s Lv 1 52 pts. 10,485
  3. Avatar for Phyx 23. Phyx Lv 1 50 pts. 10,484
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 49 pts. 10,453
  5. Avatar for MicElephant 25. MicElephant Lv 1 47 pts. 10,444
  6. Avatar for guineapig 26. guineapig Lv 1 45 pts. 10,427
  7. Avatar for AlphaFold2 27. AlphaFold2 Lv 1 44 pts. 10,413
  8. Avatar for Idiotboy 28. Idiotboy Lv 1 42 pts. 10,407
  9. Avatar for jausmh 29. jausmh Lv 1 41 pts. 10,396
  10. Avatar for Keresto 30. Keresto Lv 1 40 pts. 10,381

Comments