Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Australia 11. Australia 2 pts. 10,084
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,074
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,757
  4. Avatar for Russian team 14. Russian team 1 pt. 9,747
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,615
  6. Avatar for Team China 16. Team China 1 pt. 9,522
  7. Avatar for Team Canada 17. Team Canada 1 pt. 8,962
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 8,857
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,241
  1. Avatar for BarrySampson 31. BarrySampson Lv 1 38 pts. 10,379
  2. Avatar for georg137 32. georg137 Lv 1 37 pts. 10,363
  3. Avatar for vuvuvu 33. vuvuvu Lv 1 36 pts. 10,360
  4. Avatar for PeterDav 34. PeterDav Lv 1 34 pts. 10,330
  5. Avatar for fishercat 35. fishercat Lv 1 33 pts. 10,312
  6. Avatar for deus911 36. deus911 Lv 1 32 pts. 10,301
  7. Avatar for Lotus23 37. Lotus23 Lv 1 31 pts. 10,265
  8. Avatar for Pexiixep 38. Pexiixep Lv 1 30 pts. 10,256
  9. Avatar for maithra 39. maithra Lv 1 28 pts. 10,243
  10. Avatar for phi16 40. phi16 Lv 1 27 pts. 10,235

Comments